PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_019249-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 288aa    MW: 31397.5 Da    PI: 10.6888
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_019249-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.87.8e-1181125347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG g+W  I+r     Rt  q+ s+ qky
    NNU_019249-RA  81 PWTEEEHRTFLAGLERLGRGDWLGISRNSVRSRTHTQVASHAQKY 125
                      8*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.24774130IPR017930Myb domain
SuperFamilySSF466892.77E-1676129IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-1677129IPR006447Myb domain, plants
SMARTSM007176.4E-778128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-978124IPR009057Homeodomain-like
CDDcd001676.10E-781126No hitNo description
PfamPF002499.6E-881125IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MAKETVRKCS LCGKNGHDSG TCSDKLGLKL FGVRISKQPI MKKSFSTGNL PSCTAEHNTG  60
DPGYLSDSPV LARRERKKGV PWTEEEHRTF LAGLERLGRG DWLGISRNSV RSRTHTQVAS  120
HAQKYFLRQA TSDRKKRRLS LLDVTINKKX VTTPPSNLTN LFFLLRSSRS LCVFLSPIHR  180
GAGSSCGRLT RPSATHQSVP STSMVNCPNR AYVYLPNTQT GVDSATILTH SSFNLPAQSV  240
LIQCASEAAP ATSSSVINID LELTIGLLPQ AHSGTNLPSQ QRNHSGLL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258761.11e-101PREDICTED: transcription factor MYB1R1-like isoform X1
TrEMBLA5BCS52e-53A5BCS5_VITVI; Putative uncharacterized protein
STRINGPGSC0003DMT4000556165e-45(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.15e-45MYB_related family protein